Mouse Anti-Human HSD3B7 aa 101-209 | Gentaur

Gentaur

£340.00
(No reviews yet) Write a Review
SKU:
513-DPAB-DC3313-GEN
Availability:
IN STOCK
Size:
100 µg
Adding to cart… The item has been added

Mouse Anti-Human HSD3B7 aa 101-209

Host Species Mouse
 
Species Reactivity Human
 
Immunogen HSD3B7 (NP_079469, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag. The sequence is IHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQG
 
Conjugate Unconjugated
 
Alternative Names HSD3B7; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7; CBAS1; PFIC4; SDR11E3; 3 beta-hydroxysteroid dehydrogenase type 7
 
Entrez Gene ID 80270
 
UniProt ID Q9H2F3
 

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody.